If you have been reading about Freeze-thaw cycle and want a single page that covers the useful parts, this is it: definitions, context, how it is studied, and the questions that come up repeatedly.
Last reviewed on 2025-07-31. Where a claim depends on a specific study, the study is described rather than over-claimed.
Storage recommendations for reconstituted peptides vary by sequence and intended use, so general rules remain broad. A common laboratory practice is to keep solutions cold, sometimes frozen, and protected from light, but freezing itself can damage certain peptides. The pH of the solution may be adjusted to a range where the peptide is most stable, though changing pH can also alter solubility. Documentation of reconstitution date, solvent, concentration, and storage conditions supports reproducibility. Stability data for a specific peptide are generally established by direct measurement rather than assumed from related compounds.
Once a peptide is in solution, its stability depends on temperature, pH, ionic strength, and the presence of oxygen or light. Many peptides are less stable in liquid form than as dry powders because hydrolysis, oxidation, and aggregation can proceed faster in water. Storage at low temperature slows these reactions but does not eliminate them. Some sequences are particularly sensitive to repeated freezing and thawing, which can cause precipitation or conformational changes. The container material and headspace also influence adsorption and surface-induced aggregation.
The concentration of a reconstituted peptide is calculated from the mass of peptide powder and the volume of solvent added. This calculation assumes the powder contains only peptide, but many preparations include counterions, water, or salts. Analytical methods such as ultraviolet absorbance or amino acid analysis can estimate actual peptide content. The relationship between nominal and actual concentration is an area where measurements matter. Open questions remain about how aggregation changes the effective concentration in solution.
Peptide reconstitution is the process of dissolving a lyophilized peptide in a liquid to form a solution for later use. Lyophilization removes water under vacuum, leaving a dry powder or porous cake. Reconstitution reintroduces solvent so the peptide molecules return to a dissolved state. The solvent may be purified water, a buffer, or a mixture containing an organic co-solvent. The choice depends on the peptide sequence, its charge, and its hydrophobicity.
| Property | Value | Notes |
|---|---|---|
| Solution appearance | Clear to slightly opalescent | Cloudiness can signal aggregation or undissolved material. |
| Typical short-term storage | 2-8 °C | Refrigeration is common for solutions used within a short period. |
| Typical long-term storage | -20 °C or lower | Freezing may require aliquoting to avoid repeated freeze-thaw cycles. |
| Common container | Low-binding plastic or glass vial | Low-binding surfaces can reduce adsorptive loss. |
| Common preservative | Bacteriostatic water | Contains an antimicrobial agent; not compatible with all analytical workflows. |
Aseptic technique matters when the solution will contact cells or biological reagents. Working in a clean environment, using sterile liquids and containers, and minimizing open-vial time reduce the chance of microbial contamination. Filtration through a sterile filter can remove particles and microorganisms, but some filters adsorb peptides and some peptides are retained by certain membrane materials. Compatibility between the peptide, solvent, and filter should be checked when recovery is critical.
Quality verification after reconstitution may include visual inspection, pH measurement, and chromatographic analysis. Reverse-phase high-performance liquid chromatography can reveal degradation peaks, while mass spectrometry can confirm molecular identity. Concentration may be estimated from the weighed peptide mass or determined by amino acid analysis, UV absorbance, or quantitative chromatography. Documentation of solvent, volume, date, and storage conditions supports traceability and reproducibility. Records also help identify when a solution was prepared and whether it has exceeded an established in-house shelf life.
After a dried peptide is dissolved, the resulting solution is treated as a distinct material with its own stability profile. Temperature, pH, ionic strength, and peptide concentration all influence how long the solution remains suitable for its intended laboratory use. Some sequences are prone to oxidation, deamidation, or aggregation. Because these processes vary widely, no single storage condition applies to every peptide. Buffer composition and light exposure can also shift degradation rates.
After a peptide solution is prepared, its handling conditions influence how long it remains suitable for use. Solutions are typically separated into small portions to avoid repeated freeze-thaw cycles, which can promote aggregation or precipitation. Containers are chosen to minimize adsorption, especially for peptides that are hydrophobic or present at low concentration. Some laboratories use low-binding plastic tubes or add a carrier protein, although carrier addition can interfere with later analysis. Records usually note the solvent, date, and storage temperature for traceability.
Storage stability of a reconstituted peptide depends on concentration, pH, buffer composition, and the presence of oxygen or microbial contaminants. Short-term storage is often at refrigerated temperatures, while longer-term storage may use freezing at -20 °C or -80 °C. Repeated warming and cooling can cause losses through adsorption or aggregation, so aliquots are preferred. Light-sensitive peptides require protection from ambient light. Sterile filtration may be used when microbial control is needed, but filters can adsorb peptides and reduce recovery.
After a peptide is reconstituted, analytical checks can confirm identity, concentration, and purity. Reverse-phase high-performance liquid chromatography separates the peptide from related impurities and can estimate purity by peak area. Mass spectrometry provides a mass value that supports sequence identity, while ultraviolet absorbance at 214 or 280 nanometers is often used for concentration estimation when the extinction coefficient is known. These methods answer different questions and are complementary. A single measurement rarely establishes full quality, because the same sample can appear acceptable by one method and fail another.
Concentration calculations depend on the amount of peptide present in the vial and the volume of solvent added. Lyophilized preparations often contain counterions, salts, or residual water, so the labeled mass may not equal the mass of the peptide itself. This difference can produce a calculated concentration that is higher than the true peptide concentration. Analytical determination of peptide content, rather than reliance on the vial label alone, reduces this source of error. Uncertainty in volume measurement also contributes, especially when small liquid volumes are handled.
Quality records typically include a certificate of analysis, batch number, molecular weight, purity result, and recommended storage conditions. After reconstitution, a laboratory log may record solvent, final volume, date, and storage location. Such documentation supports reproducibility and allows later investigation if a preparation behaves unexpectedly. Stability studies often examine purity and concentration over time under defined temperatures, but results are not universally transferable between peptides or formulations. Open questions remain about how best to predict aggregation for specific sequences and how much analytical testing is sufficient for routine laboratory work.
The choice of liquid depends on peptide sequence, counterion content, and intended analysis. Water is sufficient for many hydrophilic peptides, while hydrophobic sequences may need a small amount of organic solvent or a buffer. pH can affect charge, solubility, and stability, so the target value is usually selected for the specific peptide. Exact laboratory protocols vary by supplier and application, and no single solvent reliably works for every different peptide.
Reconstitution involves considerably more than simply adding liquid. The solid must wet completely, and gentle mixing should avoid foaming, which can denature some peptides. Insoluble particles may indicate incomplete dissolution, aggregation, or insoluble excipients. The resulting concentration is calculated from the weighed peptide mass and the final volume, not from the volume of liquid added alone. Because peptides can adsorb to surfaces, container material and transfer steps can influence recovery, especially at low concentrations.
The first generation uses linking technologies that conjugate drugs non-selectively to cysteine or lysine residues in the antibody, resulting in a heterogeneous mixture. This approach leads to suboptimal safety and efficacy and complicates optimization of the biological, physical and pharmacological properties. Site-specific incorporation of unnatural amino acids generates a site for controlled and stable attachment. This enables the production of homogeneous ADCs with the antibody precisely linked to the drug and controlled ratios of antibody to drug, allowing the selection of a best-in-class ADC. An Escherichia coli-based open cell-free synthesis (OCFS) allows the synthesis of proteins containing site-specifically incorporated non-natural amino acids and has been optimized for predictable high-yield protein synthesis and folding. The absence of a cell wall allows the addition of non-natural factors to the system to manipulate transcription, translation and folding to provide precise protein expression modulation.
At the present time the Department promotes various scientific fields, running the whole gamut of base branches of classical physical chemistry: thermodynamics, kinetics, electrochemistry, catalysis, sorption processes. As the subjects of research, organic compounds unite all the aforesaid research areas. Over the last years staff members of the Department of Physical Chemistry made reports at conferences in many countries of the world: Canada, Poland, Republic of South Africa, Italy, Germany, Portugal, Czech Republic, USA, Ireland, Croatia, Spain, Sweden, Japan, Brazil. The head of the Department is Professor Boris N. Solomonov, Doctor of Science in Chemistry. The Department conducts research in the following fields:
HA (aq) + H2O (l) ⇌ H3O+ (aq) + A− (aq) Ka Common examples of monoprotic acids in mineral acids include hydrochloric acid (HCl) and nitric acid (HNO3). On the other hand, for organic acids the term mainly indicates the presence of one carboxylic acid group and sometimes these acids are known as monocarboxylic acid. Examples in organic acids include formic acid (HCOOH), acetic acid (CH3COOH) and benzoic acid (C6H5COOH). Polyprotic acids, also known as polybasic acids, are able to donate more than one proton per acid molecule, in contrast to monoprotic acids that only donate one proton per molecule. Specific types of polyprotic acids have more specific names, such as diprotic (or dibasic) acid (two potential protons to donate), and triprotic (or tribasic) acid (three potential protons to donate). Some macromolecules such as proteins and nucleic acids can have a very large number of acidic protons. A diprotic acid (here symbolized by H2A) can undergo one or two dissociations depending on the pH. Each dissociation has its own dissociation constant, Ka1 and Ka2.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
Andexanet alfa is a biologic agent, a recombinant modified version of human activated factor X (FXa). Andexanet alfa differs from native FXa due to the removal of a 34 residue fragment that contains the Gla domain. This modification reduces andexanet alfa's anticoagulant potential. Additionally, a serine to alanine (S419A) mutation in the active site eliminates its activity as a prothrombin to thrombin catalyst, but still allows the molecule to bind to FXa inhibitors. FXa inhibitors bind to andexanet alfa with the same affinity as to natural FXa. As a consequence, in the presence of andexanet alfa, natural FXa is partially freed, which can lead to effective hemostasis. In other words, it acts as a decoy receptor. Andexanet alfa reverses effect of all anticoagulants that act directly through FXa or by binding antithrombin III. The drug is not effective against factor IIa inhibitor dabigatran. Its activity is measured using the anti-Xa test, which is utilized to determine the amount of available factor Xa for coagulation
Sources: en.wikipedia.org
A few bacteria have chemical systems that generate light. This bioluminescence often occurs in bacteria that live in association with fish, and the light probably serves to attract fish or other large animals. Bacteria often function as multicellular aggregates known as biofilms, exchanging a variety of molecular signals for intercell communication and engaging in coordinated multicellular behaviour. The communal benefits of multicellular cooperation include a cellular division of labour, accessing resources that cannot effectively be used by single cells, collectively defending against antagonists, and optimising population survival by differentiating into distinct cell types. For example, bacteria in biofilms can have more than five hundred times the increased resistance to antibacterial agents than individual "planktonic" bacteria of the same species. One type of intercellular communication by a molecular signal is called quorum sensing. Quorum sensing determines whether the local population is dense enough to support investment in processes that are only successful if large numbers of similar organisms behave similarly, such as excreting digestive enzymes or emitting light. Quorum sensing enables bacteria to coordinate gene expression and to produce, release, and detect autoinducers or pheromones that accumulate with the growth in cell population.
The period from 1958 to 1968 saw tremendous growth in aviation. Improvements in aviation safety and accident investigation procedures were rapidly advancing. In 1963, the Civil Aeronautics Board, under the leadership of then Deputy Director Bobbie R. Allen, established the National Aircraft Accident Investigation School in Oklahoma City. The ICAO's third accident investigation division meeting, held in Montreal, Canada, in January 1965, laid the foundation for accident investigations throughout the world. The proposals were presented by the Director of the Civil Aeronautics Board Bureau of Safety, Bobbie R. Allen, who headed the U.S. delegation. The U.S. formally adopted the proposals at the White House on December 1, 1965. The top 10 countries with the highest number of fatal civil airliner accidents from 1945 to 2021 are the United States, Russia, Canada, Brazil, Colombia, United Kingdom, France, Indonesia, Mexico, and India. The United Kingdom is noted to have the highest number of air crashes in Europe, with a total of 110 air crashes within the time period, and Indonesia is the highest in Asia at 104, followed by India at 95.
The Tandem Diabetes Care t:Slim X2 was approved by the U.S. Food and Drug Administration in 2019 and is the first insulin pump to be designated as an alternate controller enabled (ACE) insulin pump. ACE insulin pumps allow users to integrate continuous glucose monitors, automated insulin dosing (AID) systems, and other diabetes management devices with the pump to create a personalized diabetes therapy system. Many users of the t:slim X2 integrate the pump with the Dexcom G6, a continuous glucose monitor approved by the FDA in 2018. It was the first CGM authorized for use in an integrated therapy system. The device does not require fingerstick calibrations.
The histology of ALK-negative ALCL, similar to ALK-positive ALCL, consist of "hallmark" cells that strongly express CD30. Unlike ALK-positive ALCL, however, ALK-negative ALC does not fall into different morphological patterns. The histological of this disease may overlap with and be difficult to distinguish from other CD30-positive T-cell lymphomas or the nodular sclerosis form of Hodgkin lymphoma. Cases in which ALK-negative ALCL is not distinguishable from the latter lymphomas are best diagnosed as peripheral T-cell lymphoma not otherwise specified (PTL, NOS). The histology of ALK-negative ALCL may also overlap with tumors of non–T-cell lineage such as various carcinomas. The differential diagnoses of ambiguous cases may be helped by examining the tumor cells for the expression of certain marker proteins. For example, expression of CD56, MUC1 (also termed EMA for epithelial membrane antigen), and clusterin and strong uniform expression of CD30 support the diagnosis of ALK-negative ALCL over PTL, NOS, while variable CD30 expression and extensive expression of T-cell receptor proteins favor PTCL-NOS over ALK-negative ALCL. Detection of certain gene abnormalities (see next section) may also help distinguishing these diseases.
Sources: en.wikipedia.org
Storage time depends on peptide sequence, concentration, solvent, and temperature. No single shelf life applies to all peptides. Stability should be determined by analytical testing for the specific preparation.
Aliquots limit the number of freeze-thaw cycles a solution undergoes. Repeated temperature changes can cause aggregation, precipitation, or loss of peptide to container surfaces. Single-use portions also reduce contamination risk when handled aseptically.
Some amino acid side chains, such as tryptophan and tyrosine, can undergo photo-oxidation. Amber vials or foil wrapping are used to reduce light exposure in laboratory settings. The sensitivity varies widely among peptides.
Lyophilization removes water to produce a dry peptide preparation. Reconstitution adds a solvent back to that preparation to create a liquid solution. The two processes are complementary steps in the lifecycle of many peptide products.