The short version of RP-HPLC fits in a sentence. The long version — which is the one that helps — is below.
Reviewed 2025-09-11. Anything still debated is marked as such rather than presented as settled.
Reconstitution concentration is chosen from the mass of peptide and the volume of solvent added. Researchers often prepare a concentrated stock and then divide it into single-use aliquots to reduce freeze-thaw cycling. The actual peptide content may differ from label mass because of counterions, water, or impurities. For that reason, quantitative work may require independent measurement such as amino acid analysis or ultraviolet absorbance. Records of solvent, volume, date, and lot help trace later observations.
Lyophilized peptides are supplied as dry powders or porous cakes that remain stable during shipment and short-term storage. Reconstitution is the laboratory step of adding a suitable solvent so the solid dissolves into a liquid stock. The dried state limits hydrolysis and microbial growth, but it does not remove all residual water or salts. Sequence, counterion, and manufacturing method influence how quickly and completely a peptide enters solution. Researchers treat reconstitution as a practical starting point for later dilution, analysis, or assay work.
Solvent choice depends on peptide polarity and intended use. Many peptides dissolve in water or buffered aqueous solutions, while hydrophobic sequences may need a small amount of organic solvent such as acetonitrile or dimethyl sulfoxide before aqueous dilution. The solvent should match the downstream analytical method and not interfere with detection. Gentle mixing or brief sonication can help, but vigorous agitation may promote foaming or aggregation. Complete dissolution is judged by a clear liquid free of visible particles, though some turbidity can persist.
Analytical checks help determine whether a reconstituted peptide matches its expected identity and purity; reverse-phase high-performance liquid chromatography separates components by hydrophobicity and can reveal degradation products or impurities. Mass spectrometry provides a mass measurement that supports sequence identity when compared with the theoretical value. Ultraviolet absorbance at 280 nm can estimate concentration for peptides containing tryptophan or tyrosine, though sequence-dependent extinction coefficients are needed. For shorter or non-aromatic peptides, other methods such as amino acid analysis may be required. These techniques describe the material rather than guarantee its biological effect.
Cloudiness, particles, or gel formation after reconstitution can signal incomplete dissolution, aggregation, or contamination. A clear solution is not proof of purity, and a cloudy one is not always unusable if the peptide is designed to form suspensions. pH measurement can identify whether the solution matches the intended range, and buffer exchange may be needed when the original solvent is incompatible. Sterile filtration is sometimes used for microbial control, but filters can adsorb peptides and reduce concentration. Documentation of lot number, solvent, volume, date, and storage condition supports later traceability in laboratory records.
| Property | Value | Notes |
|---|---|---|
| Appearance (lyophilized) | White to off-white powder or cake | Depends on peptide sequence, counterion, and manufacturing process |
| Appearance (reconstituted) | Clear to slightly hazy solution | Visible particles may indicate incomplete dissolution or aggregation |
| Solubility class | Aqueous or organic-dependent | Hydrophilic peptides often dissolve in water; hydrophobic peptides may require acetonitrile or dimethyl sulfoxide |
| Typical storage temperature (lyophilized) | -20 °C or lower | Desiccated, protected from light, and allowed to equilibrate before opening |
| Typical analytical method | Reverse-phase HPLC or LC-MS | Used to confirm identity, purity, and concentration after dissolution |
Peptide reconstitution is the addition of a liquid to a dried peptide preparation so that the peptide dissolves and forms a solution. Many research peptides are supplied as lyophilized powders, a form produced by freezing and then removing solvent under vacuum. The dried material often appears as a cake or fluffy powder. Dissolution depends on the peptide's sequence, charge, and hydrophobicity. Not all peptides dissolve equally in the same liquid.
The choice of solvent is guided by peptide properties and the intended downstream use. Water alone can dissolve many hydrophilic peptides, while hydrophobic sequences may require a small amount of an organic solvent or a buffered solution. Some peptides carry net charges that affect solubility across pH values. The pH of the final solution can influence stability and aggregation. In research settings, the solvent is selected to match the assay or analytical method rather than for any therapeutic purpose.
Lyophilization removes water from a peptide solution under vacuum, leaving a porous cake or a loose powder. The dry form often improves stability during shipping and storage because water-mediated degradation slows. Reconstitution reverses the process by adding a solvent so peptide molecules hydrate and enter solution. Complete dissolution depends on peptide sequence, purity, salt form, and any excipients present. Some lyophilized powders dissolve quickly, while others form haze, gels, or persistent particles.
Solvent selection affects pH, ionic strength, and preservative content in the final liquid. Sterile water and bacteriostatic water containing benzyl alcohol are common in laboratory settings. Buffer systems may be used when a peptide is sensitive to pH shifts during dissolution. Acidic or basic conditions can change the net charge of ionizable groups and therefore solubility. Organic cosolvents are sometimes added for hydrophobic sequences, though they can also promote unfolding or aggregation.
During reconstitution, solvent penetrates the powder, breaks interparticle contacts, and solvates polar and nonpolar groups. Gentle mixing or swirling can speed dissolution, while vigorous shaking may introduce foaming and surface denaturation. Aggregation becomes more likely when the peptide concentration exceeds its solubility or when the pH is near the isoelectric point. The link between a specific reconstitution method and long-term stability is not fully predictable from sequence alone. How excipients, container surfaces, and residual moisture influence aggregation remains an open question.
The citric acid cycle is regulated mainly by the availability of key substrates, particularly the ratio of NAD+ to NADH and the concentrations of calcium, inorganic phosphate, ATP, ADP, and AMP. Citrate – the ion that gives its name to the cycle – is a feedback inhibitor of citrate synthase and also inhibits PFK, providing a direct link between the regulation of the citric acid cycle and glycolysis.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
The only drug currently approved for stroke treatment is tPA, which can cause dangerous brain bleeding. In 2005, Griffin et al proposed using Activated Protein C in conjunction with tPA to protect the brain from tPA’s harmful side-effects. APC activates protease-activated receptor 1 (PAR-1), which plays a role in the interaction of coagulation and inflammation. The 3K3A-APC was designed to have more activity at protease-activated receptor 1 (PAR-1) and less anticoagulative effect than activated protein C. The phase 2 trial, RHAPSODY, was performed in the lab of Berislav Zlokovic, the scientific founder of ZZ Biotech, to determine safety and tolerability of the drug. A phase 3 $30 million trial, RHAPSODY-2, was planned to determine safety and efficacy for treatment of ischemic stroke. However, on November 16, 2023, the National Institutes of Health (NIH) paused the start of the human trial of 3K3A-APC after an investigation by Science Magazine.
Pinhasov is a researcher at the Department of Molecular Biology and Dr. Miriam and Sheldon G. Adelson School of Medicine. His research focuses on the molecular mechanisms of mental disorders and the relationship between psychiatric deviations and stress sensitivity. His laboratory group has developed a selectively bred mouse model with strong features of dominance and submissiveness. These mice respectively exhibit manic-like and depression-like behavior with different responses to psychotropic agents and environmental stimuli, demonstrating differential sensitivity to stress. His group showed that inherited susceptibility to stress is linked to gradual development of chronic inflammation, wide-spectrum metabolic alterations, brain neurotransmission deterioration, electrical activity accompanied behavioral disturbances in emotional and cognitive domains, and reduced life expectancy. The Dominant-Submissive mouse model has been shown to be a successful and unique tool for studying the mechanisms of aging related cognitive impairments, mental disorders, and their effects on the entire organism.
Sources: en.wikipedia.org
Anti-citrullinated protein antibodies (ACPAs) are autoantibodies (antibodies to an individual's own proteins) that are directed against peptides and proteins that are citrullinated. They are present in the majority of patients with rheumatoid arthritis. Clinically, cyclic citrullinated peptides (CCP) are frequently used to detect these antibodies in patient serum or plasma (then referred to as anti–citrullinated peptide antibodies). During inflammation, arginine amino acid residues can be enzymatically converted into citrulline residues in proteins such as vimentin, by a process called citrullination. If their shapes are significantly altered, the proteins may be seen as antigens by the immune system, thereby generating an immune response. ACPAs have proved to be powerful biomarkers that allow the diagnosis of rheumatoid arthritis (RA) to be made at a very early stage. In July 2010, the 2010 ACR/EULAR Rheumatoid Arthritis Classification Criteria were introduced. These new classification criteria include ACPA testing, and overruled the "old" ACR criteria of 1987 and are adapted for early RA diagnosis.
An organic compound is a chemical whose molecules contain carbon. Carbon is abundant in the Sun, stars, comets, and in the atmospheres of most planets of the Solar System. Organic compounds are relatively common in space, formed by "factories of complex molecular synthesis" which occur in molecular clouds and circumstellar envelopes, and chemically evolve after reactions are initiated mostly by ionizing radiation. Purine and pyrimidine nucleobases including guanine, adenine, cytosine, uracil, and thymine, as well as sugars, have been found in meteorites. These could have provided the materials for DNA and RNA to form on the early Earth. The amino acid glycine was found in material ejected from comet Wild 2; it had earlier been detected in meteorites. Comets are encrusted with dark material, thought to be a tar-like organic substance formed from simple carbon compounds under ionizing radiation. A rain of material from comets could have brought such complex organic molecules to Earth. During the Late Heavy Bombardment, meteorites may have delivered up to five million tons of organic prebiotic elements to Earth per year. Currently 40,000 tons of cosmic dust falls to Earth each year.
Bacillus virus φ29 (bacteriophage φ29) is a double-stranded DNA (dsDNA) bacteriophage with a prolate icosahedral head and a short tail that belongs to the genus Salasvirus, order Caudovirales, and family Salasmaviridae. They are in the same order as phages PZA, φ15, BS32, B103, M2Y (M2), Nf, and GA-1. First discovered in 1965, the φ29 phage is the smallest Bacillus phage isolated to date and is among the smallest known dsDNA phages. φ29 has a unique DNA packaging motor structure that employs prohead packaging RNA (pRNA) to guide the translocation of the phage genome during replication. This novel structure system has inspired ongoing research in nanotechnology, drug delivery, and therapeutics. In nature, the φ29 phage infects Bacillus subtilis, a species of gram-positive, endospore-forming bacteria that is found in soil, as well as the gastrointestinal tracts of various marine and terrestrial organisms, including human beings.
Sources: en.wikipedia.org
The solvent depends on peptide sequence and application. Water or aqueous buffer works for many hydrophilic peptides, while hydrophobic peptides may require a water-miscible organic solvent. The chosen solvent must be compatible with the assay or analytical instrument.
No. Some material may remain as insoluble particles, adsorb to surfaces, or degrade during handling. Recovery can be checked by analytical methods such as chromatography or mass spectrometry.
Aliquoting limits repeated freezing and thawing, which can cause aggregation or loss. Single-use portions also reduce contamination risk. Storage conditions depend on peptide stability.
Short-term storage is often under refrigeration, while longer storage may use freezing at -20 °C or lower. The choice depends on peptide stability and the solvent. Dividing the solution into aliquots reduces repeated temperature changes.